>2e3v_B mol:protein length:122  Neural cell adhesion molecule 1, 140 kDa isoform
GSSGSSGPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYD
AKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGSG
PSSG