>2e7a_A mol:protein length:157  Tumor necrosis factor
VRSSSRTPSDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY
SQVLFSGQGCPSTHVLLTHTISRISTTHNQPVNLLSAIRSPCQRETPEGAEANPWYEPI
YLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL