>2ebj_B mol:protein length:192  Pyrrolidone carboxyl peptidase
MILVTGFEPFGSLEHNPSQALLDLLPSEVDGKPLRKAVLPVDAEALGEALEDLHREGPK
AVLHLGLAEDRPVLTLERLAVNLLDFPRPDNRGRVLEDLPIVPGGPLALPARFPVKPVL
ARWREAGIPGRPSLSAGSYLCNQAFYLSLYRLPEEVPVGFLHLPPDETLALKRPRPYVP
LEVQARAVRLALEHL