>2eif_A mol:protein length:136  PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)
MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVK
KEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEV
EYIEAVGQYKITRVIGGK