>2emf_A mol:protein length:46  Zinc finger protein 484
GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG
>2emf_A mol:protein length:46  Zinc finger protein 484
GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG