>2eqg_A mol:protein length:49  Tumor necrosis factor, alpha-induced protein 3
GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG
>2eqg_A mol:protein length:49  Tumor necrosis factor, alpha-induced protein 3
GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG