>2exg_A mol:protein length:101  Afadin
GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAA
GDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIY