>2f4v_E mol:protein length:162  30S ribosomal protein S5
MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAG
YYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDI
LTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG