>2f4v_G mol:protein length:156  30S ribosomal protein S7
MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPL
KVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAV
RIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW