>2f4v_R mol:protein length:88  30S ribosomal protein S18
MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLS
GKEQRILAKTIKRARILGLLPFTEKLVRK