>2fbw_A mol:protein length:621  Succinate dehydrogenase flavoprotein subunit
STKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVA
AQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFS
RTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYF
ALDLLMENGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAM
VTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLA
SRDVVSRSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTK
EPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANS
LLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNM
QKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLC
ALQTIYGAEARKESRGAHAREDYKLRIDEFDYSKPLQGQQKRPFEEHWRKHTLSYVDVK
SGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY