>2fbw_D mol:protein length:103  Succinate dehydrogenase cytochrome B, small subunit
GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYV
HGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWSI