>2fbw_P mol:protein length:141  Succinate dehydrogenase cytochrome B, large subunit
MATTAKEEMARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSVA
ALLLPEQFPHYVAVVKSLSLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQ
VEQSGVVVLILTLLSSAGIAAIS