>2fg5_A mol:protein length:192  Ras-related protein Rab-31
MGSSHHHHHHSSGLVPRGSAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGAS
FMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWV
KELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELF
QGISRQIPPLDPHEN
>2fg5_A mol:protein length:192  Ras-related protein Rab-31
MGSSHHHHHHSSGLVPRGSAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGAS
FMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWV
KELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELF
QGISRQIPPLDPHEN