>2fi5_E mol:protein length:223  Cationic trypsin
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVE
GNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLI
SGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDS
GGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN