>2fi5_I mol:protein length:58  Pancreatic trypsin inhibitor
RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGSRAKRNNFKSAEDCMRTCGGA