>2fib_B mol:protein length:4  GLY-PRO-ARG-PRO
GPRP
>2fib_B mol:protein length:4  GLY-PRO-ARG-PRO
GPRP
>2fib_A mol:protein length:269  FIBRINOGEN
VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGS
VDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTA
DYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDN
DKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYS
MKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV