>2fin_A mol:protein length:242  rabbitpox encoded CC chemokine inhibitor
MPASLQQSSSSSSSCTEEENKHHMGIDVIIKVTKQDQTPTNDKICQSVTEITESESDPD
PEVESEDDSTSVEDVDPPTTYYSIIGGGLRMNFGFTKCPQIKSISESADGNTVNARLSS
VSPGQGKDSPAITHEEALAMIKDCEVSIDIRCSEEEKDSDIKTHPVLGSNISHKKVSYE
DIIGSTIVDTKCVKNLEFSVRIGDMCKESSELEVKDGFKYVDGSASKGATDDTSLIDST
KLKACV