>2fv7_B mol:protein length:331  Ribokinase
MGSSHHHHHHSSGLVPRGSWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIG
FGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTA
SIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMAR
RSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKR
GCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLS
LEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLF
>2fv7_A mol:protein length:331  Ribokinase
MGSSHHHHHHSSGLVPRGSWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIG
FGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTA
SIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMAR
RSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKR
GCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLS
LEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLF
>2fv7_B mol:protein length:331  Ribokinase
MGSSHHHHHHSSGLVPRGSWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIG
FGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTA
SIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMAR
RSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKR
GCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLS
LEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLF