>2fyu_I mol:protein length:78  Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQA
AGRPLVASVSLNVPASVRY