>2g33_A mol:protein length:150  Core antigen
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAI
LAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEY
LVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
>2g33_A mol:protein length:150  Core antigen
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAI
LAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEY
LVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
>2g33_C mol:protein length:150  Core antigen
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAI
LAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEY
LVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
>2g33_D mol:protein length:150  Core antigen
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAI
LAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEY
LVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
>2g33_B mol:protein length:150  Core antigen
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAI
LAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEY
LVSFGVWIRTPPAYRPPNAPILSTLPETTVVC