>2g33_A mol:protein length:150  Core antigen
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAI
LAWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEY
LVSFGVWIRTPPAYRPPNAPILSTLPETTVVC