>2gao_B mol:protein length:208  GTP-binding protein SAR1a
MGSSHHHHHHSSGLVPRGSNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDR
LGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRL
VESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKE
LNARPMEVFMCSVLKRQGYGEGFRWLSQYID