>2gix_A mol:protein length:208  Inward rectifier potassium channel 2
GSHGRSRFVKKDGHCNVQFINVGEKRNETLVFSHNAVIAMRDGKLCLMWRVGNLQKSHL
VEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYD
LSKQDIDNADFEIVVILEGMVEATAMTKQCRSSYLANEILWGHRYEPVLFEEKHYYKVD
YSRFHKTYEVPNTPLCSARDLAEKKYILSNA