>2gnj_I mol:protein length:20  cAMP-dependent protein kinase inhibitor alpha
TTYADFIASGRTGRRNAIHD
>2gnj_A mol:protein length:350  cAMP-dependent protein kinase, alpha-catalytic subunit
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYM
VMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIKVADFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHK
WFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
>2gnj_I mol:protein length:20  cAMP-dependent protein kinase inhibitor alpha
TTYADFIASGRTGRRNAIHD