>2gsb_A mol:protein length:119  Ras GTPase-activating protein 1
GSSGSSGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRT
NENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQSGPSS
G
>2gsb_A mol:protein length:119  Ras GTPase-activating protein 1
GSSGSSGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRT
NENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQSGPSS
G