>2gzg_A mol:protein length:86  Colicin-E9 immunity protein
MELKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYFPKEG
DDDSPSGIVNTVKQWRAANGKSGFKQG