>2hj8_A mol:protein length:88  Interferon-induced 17 kDa protein
MDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLP
LGEYGLKPLSTVFMNLRLRGGLEHHHHHH