>2hp4_B mol:protein length:114  T-cell surface glycoprotein CD8 alpha chain
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKA
AEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
>2hp4_B mol:protein length:114  T-cell surface glycoprotein CD8 alpha chain
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKA
AEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA
>2hp4_A mol:protein length:114  T-cell surface glycoprotein CD8 alpha chain
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGASWLFQPRGAAASPTFLLYLNQNKPKA
AEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPA