>2hqr_A mol:protein length:223  Putative TRANSCRIPTIONAL REGULATOR
MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMVSDKNALSFV
SRIKEKHSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYRSIKALVARIEARLRFWGS
NVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRDQIVSKEQLLDAIWEEPE
MVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYPKPACEE