>2hue_C mol:protein length:84  Histone H4
MKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAK
RKTVTAMDVVYALKRQGRTLYGFGG