>2hvy_B mol:protein length:104  Small nucleolar rnp similar to gar1
MEKQGEKMKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPY
VAIKPKVSNPEIYVGEVLYVDERKRKESPKKNKEKRMKKKKRLNR
>2hvy_A mol:protein length:346  Probable tRNA pseudouridine synthase B
MARDEVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTS
HEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHG
DVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEVLEIEGRDVLFRVGVEAG
TYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYF
RKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDE
LVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLWEKRDRSHHHHHH
>2hvy_D mol:protein length:130  50S ribosomal protein L7Ae
MAAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVD
PEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMK
VKELMKHHHHHH
>2hvy_E mol:na length:65  H/ACA RNA
GGGUCCGCCUUGAGUGCCCGGGUGAGAAGCAUGAUCCCGGGUAAUUAUGGCGGACCCAC
AGAAUU
>2hvy_E mol:na length:65  H/ACA RNA
GGGUCCGCCUUGAGUGCCCGGGUGAGAAGCAUGAUCCCGGGUAAUUAUGGCGGACCCAC
AGAAUU
>2hvy_C mol:protein length:60  Ribosome biogenesis protein Nop10
MKFRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGIGRKE
K