>2hvy_D mol:protein length:130  50S ribosomal protein L7Ae
MAAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVD
PEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMK
VKELMKHHHHHH