>2hzd_A mol:protein length:82  Transcriptional enhancer factor TEF-1
MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTR
TRKQVSSHIQVLARRKSRDLVPR