>2i65_A mol:protein length:262  ADP-ribosyl cyclase 1
KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKH
PCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADD
LTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKI
FDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFS
CKNIYRPDKFLQCVKNPEDSSCTSEI