>2i9w_A mol:protein length:184  Hypothetical protein
GMLFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQEVEDSDAIRADTAEHLMRT
RYSAFVLVKPEYIVKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVE
FKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVSMSVTQKQPCICGSGEKFK
RCCGMYI