>2il1_A mol:protein length:192  Rab12
MGSSHHHHHHSSGLVPRGSPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTV
GVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLP
KWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNV
DEIFLKLVDDILKKM