>2ipg_B mol:protein length:319  3(17)alpha-hydroxysteroid dehydrogenase
CHCVILNDGNFIPVLGFGTALPLECPASKAKELTKIAIDAGFHHFDSASVYNTEDHVGE
AIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAL
KPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPG
LKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPV
LGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGL
NRNMRYIPAAIFKGHPNWPFLDEY
>2ipg_B mol:protein length:319  3(17)alpha-hydroxysteroid dehydrogenase
CHCVILNDGNFIPVLGFGTALPLECPASKAKELTKIAIDAGFHHFDSASVYNTEDHVGE
AIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAL
KPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPG
LKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPV
LGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGL
NRNMRYIPAAIFKGHPNWPFLDEY
>2ipg_A mol:protein length:319  3(17)alpha-hydroxysteroid dehydrogenase
CHCVILNDGNFIPVLGFGTALPLECPASKAKELTKIAIDAGFHHFDSASVYNTEDHVGE
AIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAL
KPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPG
LKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPV
LGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGL
NRNMRYIPAAIFKGHPNWPFLDEY