>2isz_A mol:protein length:157  Iron-dependent repressor ideR
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD
RHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVK
VLNNPTTSPFGNPIPGLVELGVASENLYFQGGGHHHHHH