>2j2m_D mol:protein length:491  CATALASE
MNENEKKLTTNQGVPIGDNQNSRTAGRRGPTLLEDYQLIEKIAHFDRERVPERVVHARG
FGAHGVFKVKNSMKKYTKAAFLQEEGTEVPVFARFSTVIHGTHSPETLRDPRGFSVKFY
TEEGNWDFVGNNLPVFFIRDAMKFPDMVHSLKPDPRTNIQDPDRYWDFMTLRPESTNML
MHIFTDEGIPASYRKMRGSSVHSFKWVNAHGNTVYIKLRWVPKEGVHNLSADEATEVQG
KDFNHASNDTFQAIENGDFPEWDLFVQVLDPADVENFDFDPLDATKDWFEDVIPFQHVG
TMTLNKNVDNYFAETESVGFNPGVLVPGMLPSEDKLLQGRLFSYSDTQRHRIGPNYQQL
PINCPFAQVNNYQRDGAMPFKQQTSSVNYEPNRYQDEPKQTPEYTEDTQPLHDDIHGRL
EIEKTNNFGQAGEVYRRMTEEEQMALLNNLVNDLQQVRHENTVLLAICNFYRADASLGE
KLSEALNVDIKPFLQQMQK