>2j3t_D mol:protein length:219  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 4
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRV
GHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSL
FAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIY
SDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
>2j3t_A mol:protein length:182  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 3
GAMSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIE
DFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFV
ELPDNHSALIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNL
PAGEE
>2j3t_D mol:protein length:219  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 4
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRV
GHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSL
FAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIY
SDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
>2j3t_C mol:protein length:145  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 1
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKD
GFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLG
QTVQSELFRSRLDSYVRSLPFFSARAG
>2j3t_B mol:protein length:159  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6A
MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAF
REELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPK
FLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS