>2j3t_A mol:protein length:182  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 3
GAMSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIE
DFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFV
ELPDNHSALIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNL
PAGEE