>2j3t_D mol:protein length:219  TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 4
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRV
GHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSL
FAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIY
SDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS