>2jdq_E mol:protein length:83  POLYMERASE BASIC PROTEIN 2
GDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVM
KRKRDSSILTDSQTATKRIRMAIN