>2jm1_A mol:protein length:141  Transcriptional regulator ATRX
GAMKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSD
GMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPL
LDLVTACNSVFENLEQLLQQNKK