>2jor_A mol:protein length:79  Fibrinogen alpha chain
MIDNEKVTSGHTTTTRRSCSKVITKTVTNADGRTETTKEVVKSEDGSDCGDADFDWHHT
FPSRGNLDDFFHRDKDDFFT