>2jr7_A mol:protein length:89  DPH3 homolog
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIY
DKDQFVSGETVPAPSANKELVKLEHHHHHH