>2k1n_C mol:protein length:55  Transition state regulatory protein abrB
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ
>2k1n_B mol:protein length:55  Transition state regulatory protein abrB
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ
>2k1n_F mol:na length:25  DNA (25-MER)
AAGGTTTCCAATAATTGTCAATCAT
>2k1n_E mol:na length:25  DNA (25-MER)
ATGATTGACAATTATTGGAAACCTT
>2k1n_D mol:protein length:55  Transition state regulatory protein abrB
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ
>2k1n_F mol:na length:25  DNA (25-MER)
AAGGTTTCCAATAATTGTCAATCAT
>2k1n_A mol:protein length:55  Transition state regulatory protein abrB
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ