>2k1n_A mol:protein length:55  Transition state regulatory protein abrB
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ