>2k6m_S mol:protein length:67  Supervillin
MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVN
LKKAKGLF